>4ihb_C mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS