>4ihb_F mol:protein length:133  Dysferlin
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDL
KGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPT
GASLVLQVSYTAAAS