>4irg_A mol:protein length:109  Transcriptional regulator ERG
GAMGSGIQRPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERK
SKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPE