>4ora_A mol:protein length:544  Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
MGSSHHHHHHSSGLVPRGSHMAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLT
SEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCG
DIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLR
GNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIH
TLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVC
EFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYE
NNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQ
FDGSAAARKEIIRNKIRAIGKMARYLSVLREESESVLTLKGLTPTGMLPSGVLAGGRQT
LQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAH
ATENHGTGNHTAQ