>4wsn_O mol:protein length:222  COP9 signalosome complex subunit 7a
GGGRMSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVREL
AESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYA
VLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIART
LQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKK