>4wsn_v mol:protein length:213  COP9 signalosome complex subunit 8
GGGRMPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARY
LWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATR
RRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALD
VSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN