>4yoz_A mol:protein length:371  Retinoblastoma-like protein 1,Retinoblastoma-like protein 1
GEFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQST
DEQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACC
LEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILE
SLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETGNNRPKRTGSLALFYRKVYHLASV
RLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERT
FQEIMKSYRNQPQANSHVYRSVLLKSIKEERGDLIKFYNTIYVGRVKSFALKYDLANQD
HMMDAPPLSPFPHIKQQ
>4yoz_B mol:protein length:9  HPV E7 peptide
DLYCYEQLN
>4yoz_B mol:protein length:9  HPV E7 peptide
DLYCYEQLN