>5lk5_I mol:protein length:265  Calreticulin,Calreticulin
NKGSIEGREPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQT
SQKARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSE
YNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKI
DNSQVESGSLEDDWDFLPGSGDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYA
EEFGNETWGVTKAAEKQMKDKQDEEQRLK