>5mix_A mol:protein length:116  CD83 antigen
GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYH
QKGQNGSFDAPNERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVTGSPA
>5mix_A mol:protein length:116  CD83 antigen
GSPGTPEVKVASSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYH
QKGQNGSFDAPNERPYSLKIRNTTSSNSGTYRCTLQDPDGQRNLSGKVILRVTGSPA