>5mwf_C mol:protein length:293  Protein jagged-2
MGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPT
GPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTL
IVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYY
SATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGEC
RCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCDKDLNGSHHHHHHHH