>5ndd_A mol:protein length:619  Lysozyme,Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2
MVSAIVLYVLLAAAAHSAFAAASNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSP
SLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRR
AALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRT
GTWDAYIYEFFSVDEFSASVLTGKLTTVFLPIVYTIVFVVALPSNGMALWVFLFRTKKK
APAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYANMYCSILFL
TCLSVQRAWEIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALQITT
CHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRALADLEDNWETLNDNLK
VIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDD
ALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLENSEKKRKRAIKLAVTVAAMYLICFTP
SNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLC
RSVRTVKQMQVSLTSKAAAHHHHHHHHHH