>5nvn_D mol:protein length:38  Eukaryotic translation initiation factor 4E-binding protein 1
GPHMTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTS