>5wby_O mol:protein length:98  Proline-rich AKT1 substrate 1
GSGRETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCS
VPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEEN