>5wby_P mol:protein length:98  Proline-rich AKT1 substrate 1
GSGRETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCS
VPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEEN