>6c1a_B mol:protein length:79  Methyl-CpG-binding domain protein 2
GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT
VDLSSFDFRTGKMMPSKLQK