>6cu0_L mol:protein length:138  Tumor necrosis factor receptor superfamily member 9
SLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSST
SNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCSFGTFNDQKRGICRPWTNCS
LDGKSVLVNGTKERDVVCGP