>6e5n_B mol:protein length:87  Unconventional myosin-VI
GPLGSRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCD
IELLAACREEFHRRLKVYHAWKSKNKKR