>6f8f_D mol:protein length:145  Speckle-type POZ protein
GAMASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEES
KDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRR
DFLLDEANGLLPDDKLTLFCEVSVVQD