>6ghm_D mol:protein length:214  Apoptosis-stimulating of p53 protein 2
GPLGSMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTE
IVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADK
CEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHRED
EDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA