>6j7z_B mol:protein length:186  Oligoribonuclease, mitochondrial
MAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLD
SMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKF
LDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDAISESIKELQF
YRNNIFKKK