>6kz1_A mol:protein length:113  Whirlin
MHHHHHHSSGLEVLFQGPGSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAH
NCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML