>6mzl_O mol:protein length:218  Transcription initiation factor TFIID subunit 10
MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAG
GTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVD
FLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMK
GTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT