>6mzl_R mol:protein length:161  Transcription initiation factor TFIID subunit 12
MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLT
KKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQL
HLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK