>6rlr_A mol:protein length:90  CD9 antigen
MGSKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPK
KDVLETFTVKSCPDAIKEVFDNAAAHHHHHH