>6t90_L mol:protein length:105  Transcription factor SOX-2
MDWSHPQFEKSAVDENLYFQGGMSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEIS
KRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT