>6uuq_B mol:protein length:40  Calcipressin-1
GHMNYDLLYAISKLGPGEKYELHAATDTTPSVVITVCESD